PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0730s0008.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family EIL
Protein Properties Length: 496aa    MW: 56588.2 Da    PI: 8.4368
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0730s0008.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3180.41.8e-55431583122
                          XXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                 EIN3   3 lkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLr 92 
                          l+krmw+d+m++kr +er+k+    ke + g+kk+++s+eq+rrkkmsraQDgiLkYMlk+mevcnaqGfvYgiipe+gkpv+gasd+Lr
  Kalax.0730s0008.1.p  43 LEKRMWRDKMRIKRHRERQKN----KEGDDGSKKQQQSEEQTRRKKMSRAQDGILKYMLKMMEVCNAQGFVYGIIPENGKPVTGASDNLR 128
                          89***********66666665....6777899********************************************************** PP

                          XXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                 EIN3  93 aWWkekvefdrngpaaiskyqaknlilsge 122
                          +WWk+ v+fdrngpaai ky ++n i++ +
  Kalax.0730s0008.1.p 129 EWWKDRVRFDRNGPAAILKYMKDNSIPNPN 158
                          ************************998865 PP

2EIN3193.71.6e-59184394160353
                          TS--TTT--HHHH---S--HHHHHHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHH CS
                 EIN3 160 rrfplekgvepPWWPtGkelwwgelglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsv 249
                          rrfple+gv+p WWPtG+e+ww +lg++k qg+ppykkphdlkk wkv+vLtavikh++p++++ir+ +rqsk+lqdkm+ake+ ++++v
  Kalax.0730s0008.1.p 184 RRFPLERGVAPTWWPTGTEDWWCQLGFPKTQGPPPYKKPHDLKKLWKVGVLTAVIKHIAPNFTKIRKFVRQSKSLQDKMTAKETSTWFAV 273
                          9***************************************************************************************** PP

                          HTTTTT-S--XXXXXX..XXXXXXXXXXXXXXXXXXXX.....XXXXXX.XXXXXXXXXX............XXXXXXXXXXXXXXXXXX CS
                 EIN3 250 lnqeekecatvsahss..slrkqspkvtlsceqkedve.....gkkeskikhvqavktta............gfpvvrkrkkkpsesakv 320
                          +nqee++++++++      +++ +p    ++  ++dv       ++ ++ +h++  + t+            ++++ +krk+  +e    
  Kalax.0730s0008.1.p 274 INQEEAIARELYPPLViaCFNSYEPFESEDDLGEYDVPlaglfDDQGKNLSHSNISNLTTdtnysthieapmNLNFLSKRKA-AGEVDGS 362
                          **************544355555555555556788888999986666777777776666678999***************94.4444444 PP

                          XXX......XXXXXXX.XXXXXXXXXXXXXXXX CS
                 EIN3 321 sskevsrtcqssqfrgsetelifadknsisqne 353
                           s+  ++ c+s q+++ + +l+f+d+ s+++++
  Kalax.0730s0008.1.p 363 ASR-RVYICDSPQCPYGDIRLGFQDRASRDSHQ 394
                          444.47*************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048737.4E-5342156No hitNo description
Gene3DG3DSA:1.10.3180.104.8E-50184286IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
PfamPF048732.0E-43184278No hitNo description
SuperFamilySSF1167688.63E-43184281IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 496 aa     Download sequence    Send to blast
MGYDELGFLS GPHAEKTMPT LQNESEAILY EDSSDEDIDV DALEKRMWRD KMRIKRHRER  60
QKNKEGDDGS KKQQQSEEQT RRKKMSRAQD GILKYMLKMM EVCNAQGFVY GIIPENGKPV  120
TGASDNLREW WKDRVRFDRN GPAAILKYMK DNSIPNPNGK PHAAWSYYEH IARAAGYDTW  180
ISLRRFPLER GVAPTWWPTG TEDWWCQLGF PKTQGPPPYK KPHDLKKLWK VGVLTAVIKH  240
IAPNFTKIRK FVRQSKSLQD KMTAKETSTW FAVINQEEAI ARELYPPLVI ACFNSYEPFE  300
SEDDLGEYDV PLAGLFDDQG KNLSHSNISN LTTDTNYSTH IEAPMNLNFL SKRKAAGEVD  360
GSASRRVYIC DSPQCPYGDI RLGFQDRASR DSHQLACSFR NCSSSFQNIN YQLKPPVFNP  420
SYLQPASVDN GVVDIRQQVI GSVMSFYDKR TVLIIRLWSK LQTCPSTIRC LSETAVSLGI  480
LIIHSNLFLM ETISS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A5e-5318428630132Protein ETHYLENE INSENSITIVE 3
4zds_B5e-5318428630132Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016166039.11e-158PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein
SwissprotO246061e-143EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLA0A0R5PAD21e-159A0A0R5PAD2_CARPA; Ethylene insensitive 3-like 1
TrEMBLA0A0R5PCZ51e-159A0A0R5PCZ5_CARPA; Ethylene insensitive 3b
STRINGGLYMA14G04550.11e-157(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.11e-144EIL family protein